You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse C1qtnf3 protein
Catalog Number: orb595134
| Catalog Number | orb595134 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3) |
| Tag | N-terminal 10xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 26.6 kDa |
| UniProt ID | Q9ES30 |
| Protein Sequence | QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
| Protein Length | Full Length of Mature Protein |
| Source | Baculovirus |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 23-246aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Collagenous repeat-containing sequence 26 kDa prot Read more... |
| Note | For research use only |
| Application notes | Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Mouse C1qtnf3 protein [orb605136]
Greater than 90% as determined by SDS-PAGE.
31.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse C1qtnf3 protein [orb605285]
Greater than 85% as determined by SDS-PAGE.
26.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μg 
Mouse C1QTNF3 ELISA Kit [orb407937]
Mouse
3.12 ng/mL-200 ng/mL
0.78 ng/mL
48 T, 24 T, 10 x 96 T, 5 x 96 T, 96 T- Item 1 of 1
Mouse C1q Tumor Necrosis Factor Related Protein 3 (C1QTNF3) ELISA Kit [orb781465]
Mouse
0.32-20 ng/mL
0.137 ng/mL
96 T, 48 T
