Mouse C1qtnf3 protein

• Catalog Number: orb605136
• Category: Proteins
• Description: Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 31.1 kDa
• UniProt ID: Q9ES30
• Protein Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Expression Region: 23-246aa
• Endotoxins: Not test.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: C1qtnf3; Cors26; Ctrp3; Complement C1q tumor necro
• Note: For research use only
• Application notes: Full Length of Mature Protein
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.