You have no items in your shopping cart.
Mouse C1qtnf3 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Molecular Weight | 31.1 kDa |
| Expression Region | 23-246aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse C1q Tumor Necrosis Factor Related Protein 3 (C1QTNF3) ELISA Kit [orb781465]
Mouse
0.32-20 ng/mL
0.137 ng/mL
48 T, 96 TMouse C1qtnf3 (Complement C1q tumor necrosis factor-related protein 3) ELISA Kit [orb2647937]
Mouse
1.563-100ng/ml
0.938ng/ml
96 T, 48 TMouse C1qtnf3 protein [orb605285]
Greater than 85% as determined by SDS-PAGE.
26.6 kDa
Mammalian cell
20 μg, 1 mg, 100 μgMouse C1qtnf3 protein [orb595134]
Greater than 85% as determined by SDS-PAGE.
26.6 kDa
Baculovirus
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Quick Database Links
UniProt Details
−Protocol Information
Mouse C1qtnf3 protein (orb605136)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



