MMP9 Rabbit Polyclonal Antibody

• Catalog Number: orb574506
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MMP9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMP9
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 78 kDa
• Target: MMP9
• UniProt ID: P14780
• Protein Sequence: Synthetic peptide located within the following region: VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR
• NCBI: NP_004985
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: GELB, CLG4B, MMP-9, MANDP2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. MMP9 is cleaved from 78 kDa to an approximately 66 kDa mature form.

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

MMP9 in humanprostate cancer was detected using HRP/AEC red color stain. Dilution: 2-15 ug/ml.

WB Suggested Anti-MMP9 Antibody Titration: 1.25 ug/ml, Positive Control: K562 cell lysate.