You have no items in your shopping cart.
MMP3 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Equine, Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MMP3 |
| Target | MMP3 |
| Protein Sequence | Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
| Molecular Weight | 43kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MMP3 Rabbit Polyclonal Antibody [orb499574]
WB
Canine, Equine, Guinea pig, Porcine, Rat, Sheep
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlMMP3 Rabbit Polyclonal Antibody [orb578318]
IHC, WB
Bovine, Canine, Mouse, Porcine, Rabbit, Rat
Equine, Human
Rabbit
Polyclonal
Unconjugated
100 μlCleaved-MMP-3 (F100) rabbit pAb Antibody [orb763924]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MMP3 antibody - middle region (orb578317) validated by WB using Articular cartilage secretome at 1:1000.

Application: IHC, Species+tissue/cell type: Control-Human small intestine, Sample-human colorectal cancer, Primary antibody dilution: 1:100, Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP.

Sample Type: Equine Cartilage Explants, Primary Dilution: 1:1000.

WB Suggested Anti-MMP3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.
Documents Download
Request a Document
Protocol Information
MMP3 Rabbit Polyclonal Antibody (orb578317)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










