MMP3 Rabbit Polyclonal Antibody

• Catalog Number: orb578318
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MMP3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rabbit, Rat
• Reactivity: Equine, Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MMP3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 43kDa
• Target: MMP3
• UniProt ID: P08254
• Protein Sequence: Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN
• NCBI: NP_002413
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SL-1, STMY, STR1, CHDS6, MMP-3, STMY1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Equine Cartilage Explants, Primary Dilution: 1:1000.

Application: IHC, Species+tissue/cell type: Control-Human small intestine, Sample-human colorectal cancer, Primary antibody dilution: 1:100, Secondary antibody: Biotinylated pig anti-rabbit+streptavidin-HRP.

MMP3 antibody - middle region (orb578318) validated by WB using Equine Cartilage Explants at 1:1000.

WB Suggested Anti-MMP3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.