You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592823 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MMP2 |
Target | MMP2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MMP2 |
Protein Sequence | Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |
UniProt ID | P08253 |
MW | 74kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CLG4, MONA, CLG4A, MMP-2, TBE-1, MMP-II |
Note | For research use only |
NCBI | NP_004521 |
Lv, Xiaotong et al. Effects of riboflavin/ultraviolet-A scleral collagen cross-linking on regional scleral thickness and expression of MMP-2 and MT1-MMP in myopic guinea pigs PLoS One, 18, e0279111 (2023)
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: Human Lung, Isoform 3: 66kDa, Isoform 2: 69kDa, Antibody Dilution: 1.0 ug/ml.
Lanes: Lane 1: 15 ug MDA-MB-231 lysate, Lane 2: 15 ug MCF7 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:10000, Gene Name: MMP2.
MMP1 in connective tissue in ovarian carcinoma was detected using HRP/DAB brown color stain. Recommended for IHC on human tissue. Working dilution 2-10 ug/ml.
Rabbit Anti-MMP2 Antibody, Catalog Number: orb592823, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Porcine, Sheep | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Porcine, Sheep | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, ICC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Equine, Porcine, Sheep | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |