MMP2 Rabbit Polyclonal Antibody

• Catalog Number: orb592823
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MMP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MMP2
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 74kDa
• Target: MMP2
• UniProt ID: P08253
• Protein Sequence: Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
• NCBI: NP_004521
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CLG4, MONA, CLG4A, MMP-2, TBE-1, MMP-II
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Lv, Xiaotong et al. Effects of riboflavin/ultraviolet-A scleral collagen cross-linking on regional scleral thickness and expression of MMP-2 and MT1-MMP in myopic guinea pigs PLoS One, 18, e0279111 (2023)

PubMed: 36652495

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: Human Lung, Isoform 3: 66kDa, Isoform 2: 69kDa, Antibody Dilution: 1.0 ug/ml.

Lanes: Lane 1: 15 ug MDA-MB-231 lysate, Lane 2: 15 ug MCF7 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody Dilution: 1:10000, Gene Name: MMP2.

MMP1 in connective tissue in ovarian carcinoma was detected using HRP/DAB brown color stain. Recommended for IHC on human tissue. Working dilution 2-10 ug/ml.

Rabbit Anti-MMP2 Antibody, Catalog Number: orb592823, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.