MMP1 Rabbit Polyclonal Antibody

• Catalog Number: orb578315
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MMP1
• Target: MMP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Equine, Human
• Predicted Reactivity: Animal, Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
• Protein Sequence: Synthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
• UniProt ID: P03956
• MW: 54kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CLG, CLGN
• Research Area: Disease Biomarkers, Signal Transduction, Stem Cell
• Note: For research use only
• NCBI: NP_002412

Sample Type: Equine Cartilage Explants, Primary Dilution: 1:800.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.

Human Colorectal cancer sample, Human Liver Sample.

MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain. Antibody Titration: 2-10 ug/ml, Positive Control: Human epithelial cells ovarian carcinoma.

Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

species sample: Human, cell/tissue: macrophagesHuman macrophages, Dilution: 1/200.

WB Suggested Anti-MMP1 Antibody, Positive Control: Lane 1: 15 ug HT29 cell lysate. Lane 2: 15 ug HT29 cell lysate. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000.

WB Suggested Anti-MMP1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.