You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578315 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MMP1 |
Target | MMP1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Equine, Human |
Predicted Reactivity | Animal, Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1 |
Protein Sequence | Synthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF |
UniProt ID | P03956 |
MW | 54kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CLG, CLGN |
Note | For research use only |
NCBI | NP_002412 |
Sample Type: Equine Cartilage Explants, Primary Dilution: 1:800.
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml.
Human Colorectal cancer sample, Human Liver Sample.
MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain. Antibody Titration: 2-10 ug/ml, Positive Control: Human epithelial cells ovarian carcinoma.
Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
Rabbit Anti-MMP1 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
species sample: Human, cell/tissue: macrophagesHuman macrophages, Dilution: 1/200.
WB Suggested Anti-MMP1 Antibody, Positive Control: Lane 1: 15 ug HT29 cell lysate. Lane 2: 15 ug HT29 cell lysate. Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:2000.
WB Suggested Anti-MMP1 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |