You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324518 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to MED17 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ChIP, IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | MED17 |
UniProt ID | Q9NVC6 |
Protein Sequence | Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG |
NCBI | NP_004259 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CRSP6 antibody, anti CRSP77 antibody, anti DR Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunohistochemical staining of human Brain tissue using MED17 antibody
Immunohistochemical staining of HCT116 tissue using MED17 antibody
Western blot analysis of HepG2 cell lysate tissue using MED17 antibody
Immunohistochemical staining of human Brain tissue using MED17 antibody
Filter by Rating