CRSP6 Rabbit Polyclonal Antibody

• Catalog Number: orb324518
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MED17
• Target: MED17
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRSP6
• Protein Sequence: Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
• UniProt ID: Q9NVC6
• MW: 73kDa
• Tested applications: ChIP, IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CRSP6 antibody, anti CRSP77 antibody, anti DR
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_004259

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Human Brain

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

Rabbit Anti-MED17 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-CRSP6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate, MED17 is supported by BioGPS gene expression data to be expressed in HepG2.