MED17 Rabbit Polyclonal Antibody

• Catalog Number: orb588458
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MED17
• Target: MED17
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED17
• Protein Sequence: Synthetic peptide located within the following region: SAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLL
• UniProt ID: Q9NVC6
• MW: 71kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SRB4, CRSP6, CRSP77, DRIP80, TRAP80
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_004259

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.