MC3R Rabbit Polyclonal Antibody

• Catalog Number: orb589171
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MC3R
• Target: MC3R
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MC3R
• Protein Sequence: Synthetic peptide located within the following region: PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN
• UniProt ID: P41968
• MW: 35 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MC3, OB20, OQTL, BMIQ9, MC3-R
• Research Area: Epigenetics & Chromatin, Molecular Biology
• Note: For research use only
• NCBI: NP_063941.3

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human ACHN Whole Cell lysates, Antibody Dilution: 1 ug/ml.