MARCO Antibody

SKU: orb1536762

Description

MARCO Antibody

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: IHC, IHC-P (1:200), WB (1:500 - 1:1000)
• Reactivity: Human, Mouse, Rat
• Application Notes:
  Further information: The predicted MW is 43kDa/52kDa, while the observed MW by Western blot was 60kDa.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human MARCO (NP_006761.1). SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
• Target: MARCO
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS with 0.05% proclin300, 50% glycerol, pH 7.3
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MARCO, Macrophage receptor MARCO, Macrophage receptors marco, SCARA2

Quick Database Links

Gene Symbol

MARCO