Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

LY6G5C Rabbit Polyclonal Antibody (Biotin)

SKU: orb2089633

Description

LY6G5C Rabbit Polyclonal Antibody (Biotin) is a Biotin, affinity purified antibody which is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human LY6G5C. This antibody is predicted to react with Bovine, Canine, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer.

Images & Validation

Tested ApplicationsWB
Predicted ReactivityBovine, Canine, Human, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human LY6G5C
Protein SequenceSynthetic peptide located within the following region: CITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDF
Molecular Weight25kDa
PurificationAffinity Purified
ConjugationBiotin

Storage & Handling

StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

G5C, NG33, C6orf20, LY6G5CA, LY6G5CB

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.