ZNF294 Rabbit Polyclonal Antibody

SKU: orb325061

Description

Rabbit polyclonal antibody to LTN1

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF294
• Target: LTN1
• Protein Sequence: Synthetic peptide located within the following region: MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
• Molecular Weight: 200 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti C21orf10 antibody, anti C21orf98 antibody, anti FLJ11053 antibody, anti KIAA0714 antibody, anti RNF160 antibody, anti ZNF294 antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Several isoforms contain the peptide sequence including ~150 kDa and smaller isoforms from 23 to 53 kDa.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-ZNF294 Antibody Titration: 5% Milk, ELISA Titer: Dilution: 1:500, Positive Control: human LCL and mouse brains.

Quick Database Links

Gene Symbol

LTN1

UniProt

O94822

RefSeq (Protein):NP_056380