Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

ZNF294 Rabbit Polyclonal Antibody

SKU: orb325061

Description

ZNF294 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of LTN1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF294. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ZNF294
TargetLTN1
Protein SequenceSynthetic peptide located within the following region: MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
Molecular Weight200 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti C21orf10 antibody, anti C21orf98 antibody, anti FLJ11053 antibody, anti KIAA0714 antibody, anti RNF160 antibody, anti ZNF294 antibody

Similar Products

  • RNF160 Rabbit Polyclonal Antibody [orb2583]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Human, Mouse, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • RNF160 Antibody (Center) [orb163892]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • RNF160 Rabbit Polyclonal Antibody (PE) [orb483561]

    IF

    Bovine, Equine, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    PE

    100 μl
  • RNF160 Rabbit Polyclonal Antibody (HRP) [orb481380]

    ELISA,  IHC-Fr,  IHC-P

    Bovine, Equine, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • RNF160 Rabbit Polyclonal Antibody (APC) [orb1008720]

    IF

    Bovine, Equine, Human, Mouse, Rat, Sheep

    Rabbit

    Polyclonal

    APC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ZNF294 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Several isoforms contain the peptide sequence including ~150 kDa and smaller isoforms from 23 to 53 kDa.

ZNF294 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

ZNF294 Rabbit Polyclonal Antibody

WB Suggested Anti-ZNF294 Antibody Titration: 5% Milk, ELISA Titer: Dilution: 1:500, Positive Control: human LCL and mouse brains.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_056380

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

ZNF294 Rabbit Polyclonal Antibody (orb325061)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry