LEFTY2 Rabbit Polyclonal Antibody

• Catalog Number: orb588765
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LEFTY2
• Target: LEFTY2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY2
• Protein Sequence: Synthetic peptide located within the following region: MVIPSHVRTQYVALLQHSHASRSRGKRFSQNLREVAGRFLVSETSTHLLV
• UniProt ID: P57785
• MW: 40 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Eba, Ebaf, Left, Lefta, Leftb, lefty-2, lefty-B, 6
• Research Area: Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_796073.1

Sample Tissue: Mouse Kidney lysates, Antibody Dilution: 1.0 ug/ml.