You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324568 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LAS1L |
Target | LAS1L |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Equine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human LAS1L |
Protein Sequence | Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE |
UniProt ID | Q9Y4W2 |
MW | 83kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Las1-like antibody, anti dJ475B7.2 antibody, Read more... |
Note | For research use only |
NCBI | NP_112483 |
Sample Type: HT1080, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HT1080.
Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in MCF7.
WB Suggested Anti-LAS1L Antibody, Titration: 1.25 ug/mL, Positive Control: HepG2 Whole Cell.
WB | |
Bovine, Equine | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Equine, Human | |
Rabbit | |
Polyclonal | |
Biotin |
WB | |
Bovine, Equine, Human | |
Rabbit | |
Polyclonal | |
HRP |