Cart summary

You have no items in your shopping cart.

LAS1L Rabbit Polyclonal Antibody (Biotin)

LAS1L Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2134652

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2134652
CategoryAntibodies
DescriptionLAS1L Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Equine, Human
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human LAS1L
Protein SequenceSynthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
UniProt IDQ9Y4W2
MW83kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesWTS, Las1, Las1-like, dJ475B7.2
NoteFor research use only
NCBINP_112483