LAS1L Rabbit Polyclonal Antibody

• Catalog Number: orb324567
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LAS1L
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 83kDa
• Target: LAS1L
• UniProt ID: Q9Y4W2
• Protein Sequence: Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
• NCBI: NP_112483
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti Las1-like antibody, anti dJ475B7.2 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in COLO205.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: HT1080, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HT1080.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3.

WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.