Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

LAS1L Rabbit Polyclonal Antibody

SKU: orb324567

Description

LAS1L Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of LAS1L. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L. This antibody reacts with Human samples and is predicted to react with Bovine, Equine. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human LAS1L
TargetLAS1L
Protein SequenceSynthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
Molecular Weight83kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Las1-like antibody, anti dJ475B7.2 antibody

Similar Products

  • LAS1L Rabbit Polyclonal Antibody [orb324568]

    WB

    Bovine, Equine

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • LAS1L Rabbit Polyclonal Antibody [orb628380]

    ELISA,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • LAS1L Antibody (C-term) [orb1434497]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • LAS1L Rabbit Polyclonal Antibody [orb512119]

    ELISA,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • LAS1L Rabbit Polyclonal Antibody [orb3070134]

    WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl, 30 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

LAS1L Rabbit Polyclonal Antibody

Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in COLO205.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HeLa.

LAS1L Rabbit Polyclonal Antibody

Sample Type: HT1080, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HT1080.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

LAS1L Rabbit Polyclonal Antibody

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in Jurkat.

LAS1L Rabbit Polyclonal Antibody

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in MCF7.

LAS1L Rabbit Polyclonal Antibody

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3.

LAS1L Rabbit Polyclonal Antibody

WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_112483

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

LAS1L Rabbit Polyclonal Antibody (orb324567)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry