You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324567 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LAS1L |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Human |
Reactivity | Equine, Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 83kDa |
Target | LAS1L |
UniProt ID | Q9Y4W2 |
Protein Sequence | Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE |
NCBI | NP_112483 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti Las1-like antibody, anti dJ475B7.2 antibody Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human COLO205 tissue using LAS1L antibody
Western blot analysis of human Jurkat tissue using LAS1L antibody
Western blot analysis of human MCF7 tissue using LAS1L antibody
Western blot analysis of human Hela tissue using LAS1L antibody
Western blot analysis of human HT1080 tissue using LAS1L antibody
Western blot analysis of human OVCAR-3 tissue using LAS1L antibody
Western blot analysis of HepG2 cell lysate tissue using LAS1L antibody
Western blot analysis of human Fetal Brain tissue using LAS1L antibody
Western blot analysis of human Fetal Liver tissue using LAS1L antibody
Filter by Rating