Lap3 Rabbit Polyclonal Antibody

• Catalog Number: orb583306
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CXCR4
• Target: Lap3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD
• UniProt ID: Q9CPY7
• MW: 57kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Pe, Lap, Pep, Pep7, Peps, LAP-3, Lapep, Pep-7, Pep
• Note: For research use only
• NCBI: NP_077754

WB Suggested Anti-Lap3 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.