You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb333851 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to VCAM1 |
Target | L1CAM |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: GDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGA |
UniProt ID | P32004 |
MW | 140 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CD106 antibody, anti CD106 Antigen antibody, Read more... |
Note | For research use only |
NCBI | NP_000416 |
25 ug of Hela whole cell extract was loaded onto a 6-18% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.
WB Suggested Anti-L1CAM Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.
FC, WB | |
Bovine, Equine, Gallus, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, FC | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |