L1CAM Rabbit Polyclonal Antibody

• Catalog Number: orb333851
• Category: Antibodies
• Description: Rabbit polyclonal antibody to VCAM1
• Target: L1CAM
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: GDIKPLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGA
• UniProt ID: P32004
• MW: 140 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CD106 antibody, anti CD106 Antigen antibody,
• Note: For research use only
• NCBI: NP_000416

25 ug of Hela whole cell extract was loaded onto a 6-18% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

WB Suggested Anti-L1CAM Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Brain.