KMT5B Rabbit Polyclonal Antibody

• Catalog Number: orb325667
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Suv420h1
• Target: KMT5B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC
• UniProt ID: Q3U8K7
• MW: 32 kDa
• Tested applications: ChIP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti AA117471 antibody, anti C630029K18Rik antibod
• Note: For research use only
• NCBI: NP_001161356

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 2 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. Multiple isoforms of this protein are expressed in the samples shown as indicated.

Chromatin Immunoprecipitation (ChIP) Using Suv420h1 antibody - C-terminal region (orb325667) and HCT116 Cells.

Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

WB Suggested Anti-Suv420h1 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Thymus.