You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1 |
| Target | KMT5B |
| Protein Sequence | Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR |
| Molecular Weight | 99 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−KMT5B Rabbit Polyclonal Antibody [orb325667]
ChIP, WB
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
Mouse
Rabbit
Polyclonal
Unconjugated
100 μlKMT5B Rabbit Polyclonal Antibody [orb324552]
IHC, WB
Canine, Equine, Guinea pig, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlKMT5B Polyclonal Antibody [orb3149955]
ELISA, IHC, WB
Bovine, Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-SUV420H1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

WB Suggested Anti-SUV420H1 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat Whole Cell.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
KMT5B Rabbit Polyclonal Antibody (orb324551)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review






![Anti-SUV420H2 [RAB-C409]](/images/pub/media/catalog/product/NewWebsite/35/orb1089945_1.png)
![Anti-SUV420H2 [RAB-C409]](/images/pub/media/catalog/product/NewWebsite/35/orb1089945_2.png)



