You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324552 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to SUV420H1 |
Target | KMT5B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SUV420H1 |
Protein Sequence | Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR |
UniProt ID | Q4V775 |
MW | 52kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CGI85 antibody, anti KMT5B antibody, anti CGI Read more... |
Note | For research use only |
NCBI | AAH98121 |
Rabbit Anti-SUV420H1 Antibody, Paraffin Embedded Tissue: Human Skin Cellular Data: Squamous epithelial cells Antibody Concentration: 4.0-8.0 ug/mL Magnification: 400X.
WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mL ELISA Titer: 1:1562500 Positive Control: Human Placenta.
WB Suggested Anti-SUV420H1 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat Whole Cell.
IHC, WB | |
Canine, Equine, Guinea pig, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ChIP, WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |