You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324492 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KMT2B |
Target | KMT2B |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MLL4 |
Protein Sequence | Synthetic peptide located within the following region: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA |
UniProt ID | Q9UMN6 |
MW | 64kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti HRX2 antibody, anti MLL2 antibody, anti TRX2 Read more... |
Note | For research use only |
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.
WB Suggested Anti-MLL4 Antibody Titration: 5 ug/mL, Positive Control: HepG2 cell lysate, KMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.
IF, IHC-Fr, IHC-P | |
Bovine, Canine, Equine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Bovine, Canine, Equine, Human, Porcine, Rat, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
FITC |