KLF2 Antibody

SKU: orb1538606

Description

KLF2 Antibody

Research Area

Cancer Biology

Images & Validation

• Tested Applications: IHC, IHC-P, WB
• Dilution Range: IHC, IHC-P (5 µg/ml), WB (0.2 - 1 µg/ml)
• Reactivity: Mouse
• Application Notes:
  Further information: Western Blot: Suggested dilution at 1 ug/ml in 5% skim milk / PBS buffer, and HRP conjugated anti-Rabbit IgG should be diluted in 1: 50,000 - 100,000 as secondary antibody.

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: Synthetic peptide from N-Terminus of mouse Klf2 (Q60843, NP_032478) within the region MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM. Percent identity by BLAST analysis: Mouse, Zebra finch, Chicken (100%); Marmoset, Rat, Opossum (92%); Human, Gibbon, Galago, Pig (85%); Xenopus (83%).
• Target: KLF2
• Purification: Immunoaffinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 0.09% sodium azide, 2% sucrose
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

KLF2, Krueppel-like factor 2, Kruppel-like factor LKLF, Kruppel-like factor 2 (lung), Lung krueppel-like factor, LKLF

Quick Database Links

Gene Symbol

KLF2