KIR2DL1 Rabbit Polyclonal Antibody

• Catalog Number: orb585653
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIR2DL1
• Target: KIR2DL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: DEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRS
• UniProt ID: P43626
• MW: 38kDa
• Tested applications: IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NKAT, NKAT1, p58.1, CD158A, KIR221, NKAT-1, KIR-K6
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_055033

Amount and Sample Type: Lane 1: 2x107 KIR2DL1 transfected NKL cells IP Antibody, KIR2DL1 Amount of IP Antibody: Primary Antibody: KIR2DL1, Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: KIR2DL1.

Amount and Sample Type: Lane 1: 2x107 KIR3DL1 transfected NKL cells IP Antibody, KIR2DL1 Amount of IP Antibody: Primary Antibody: KIR2DL1, Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: KIR2DL1.

WB Suggested Anti-KIR2DL1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.