You have no items in your shopping cart.
KIR2DL1 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IP, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Target | KIR2DL1 |
| Protein Sequence | Synthetic peptide located within the following region: DEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRS |
| Molecular Weight | 38kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−CD158a rabbit pAb Antibody [orb767223]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Amount and Sample Type: Lane 1: 2x107 KIR2DL1 transfected NKL cells IP Antibody, KIR2DL1 Amount of IP Antibody: Primary Antibody: KIR2DL1, Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: KIR2DL1.

Amount and Sample Type: Lane 1: 2x107 KIR3DL1 transfected NKL cells IP Antibody, KIR2DL1 Amount of IP Antibody: Primary Antibody: KIR2DL1, Primary Antibody dilution: 1:250, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: KIR2DL1.

WB Suggested Anti-KIR2DL1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
Documents Download
Request a Document
Protocol Information
KIR2DL1 Rabbit Polyclonal Antibody (orb585653)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




