You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585800 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KIR2DS2 |
Target | KIR2DS2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: ETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQ |
UniProt ID | D0UWM7 |
MW | 32kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | NKAT5, cl-49, CD158J, CD158b, NKAT-5, 183ActI, KIR Read more... |
Note | For research use only |
NCBI | NP_036444 |
WB Suggested Anti-KIR2DS2 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.