Cart summary

You have no items in your shopping cart.

KIR2DS2 Rabbit Polyclonal Antibody (HRP)

KIR2DS2 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2093114

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2093114
CategoryAntibodies
DescriptionKIR2DS2 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein SequenceSynthetic peptide located within the following region: ETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQ
UniProt IDD0UWM7
MW32kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesNKAT5, cl-49, CD158J, CD158b, NKAT-5, 183ActI, KIR
Read more...
NoteFor research use only
NCBINP_036444