You have no items in your shopping cart.
Cart summary
Item 1 of 1
KALRN Rabbit Polyclonal Antibody
Catalog Number: orb589872
| Catalog Number | orb589872 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KALRN |
| Target | KALRN |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KALRN |
| Protein Sequence | Synthetic peptide located within the following region: GRKSFDLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKI |
| UniProt ID | O60229 |
| MW | 81 kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | DUO, CHD5, DUET, TRAD, CHDS5, HAPIP, ARHGEF24 |
| Note | For research use only |
| NCBI | NP_001019831.2 |
Sample Tissue: Human HCT116 Whole Cell lysates, Antibody Dilution: 1 ug/ml.
- Item 1 of 2
Anti-Kalirin Antibody [orb214848]
IF, WB
Human, Mouse, Primate, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
