You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IF, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGA2 |
| Target | ITGA2 |
| Protein Sequence | Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
| Molecular Weight | 126kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Integrin α2 rabbit pAb Antibody [orb767193]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlIntegrin α2 Polyclonal Antibody [orb1411183]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: HeLa cells, Primary Antibody dilution: 1:150, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 488, Secondary Antibody dilution: 1:800, Color/Signal Descriptions: Green: ITGA2 Blue: DAPI, Gene Name: ITGA2.

WB Suggested Anti-ITGA2 Antibody, Titration: 1.0 ug/ml, Positive Control: HT1080 Whole Cell. ITGA2 is supported by BioGPS gene expression data to be expressed in HT1080.
Documents Download
Request a Document
Protocol Information
ITGA2 Rabbit Polyclonal Antibody (orb585927)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










