IL6 Rabbit Polyclonal Antibody

• Catalog Number: orb582293
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL6
• Target: IL6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL6
• Protein Sequence: Synthetic peptide located within the following region: CFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL
• UniProt ID: P05231
• MW: 23 kDa
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CDF, HGF, HSF, BSF2, IL-6, BSF-2, IFNB2, IFN-beta-
• Note: For research use only
• NCBI: NP_000591

Sample Tissue: Human Uterus Tumor lysates, Antibody dilution: 1 ug/ml.