Cart summary

You have no items in your shopping cart.

HGF Rabbit Polyclonal Antibody

Catalog Number: orb579132

DispatchUsually dispatched within 3-7 working days
$ 600.00
Catalog Numberorb579132
CategoryAntibodies
DescriptionRabbit polyclonal antibody to IL6
TargetHGF
ClonalityPolyclonal
Species/HostRabbit
ConjugationUnconjugated
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HGF
Protein SequenceSynthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
UniProt IDP14210
MW83 kDa
Tested applicationsIHC, WB
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Alternative namesSF, HGFB, HPTA, F-TCF, DFNB39
NoteFor research use only
NCBINP_001010932
HGF Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. Protein is processed to yield 51 kDa alpha chain.

HGF Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: human liver cancer, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

HGF Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: normal human kidney, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

HGF Rabbit Polyclonal Antibody

Formalin Fixed Paraffin Embedded Tissue: normal human liver, Primary antibody concentration: 7 ug/ml, Incubation with primary antibodies: overnight at 4°C, Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate. Counterstain: Hematoxylin.

HGF Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2, Antibody Dilution: 1.0 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 3 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 293T Whole Cell lysates, Antibody Dilution: 0.2 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 721_B Cell lysates, Antibody Dilution: 1.0 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: 721_B Whole Cell lysates, Antibody Dilution: 0.5 ug/ml.

HGF Rabbit Polyclonal Antibody

Sample Type: Human HepG2 cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%.

HGF Rabbit Polyclonal Antibody

Positive control (+): Human Placenta (PL), Negative control (-): Human heart (HE), Antibody concentration: 1 ug/ml.

HGF Rabbit Polyclonal Antibody

Immunohistochemistry with Human Adrenal Gland lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HGF antibody (orb579132).

HGF Rabbit Polyclonal Antibody

WB Suggested Anti-HGF Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that HGF is expressed in HEK293T.

  • Met Polyclonal Antibody [orb1413106]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HGF purified MaxPab rabbit polyclonal antibody (D01P) [orb2292826]

    PLA,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HGF Rabbit Polyclonal Antibody [orb10794]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HGF Rabbit Polyclonal Antibody [orb579133]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • MET Rabbit Polyclonal Antibody [orb10422]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl