Human TGF beta 1 protein

SKU: orb604408

Description

This Human TGF beta 1 protein spans the amino acid sequence from region 281-390aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 281-390aa
• Protein Length: Partial
• MW: 16.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Cartilage-inducing factor, CED, Differentiation inhibiting factor, DPD1, LAP, Latency-associated peptide, Prepro transforming growth factor beta 1, TGF beta 1, TGF beta, TGF beta 1 protein, TGF-beta 1 protein, TGF-beta-1, TGF-beta-5, TGF-beta1, TGFB, Tgfb-1, tgfb1, TGFB1_HUMAN, TGFbeta, TGFbeta1, Transforming Growth Factor b1, Transforming Growth Factor beta 1, Transforming growth factor beta 1a, transforming growth factor beta-1, transforming growth factor, beta 1, Transforming Growth Factor-?

Quick Database Links

UniProt

P01137