TGFB1 Rabbit Polyclonal Antibody

• Catalog Number: orb576457
• Category: Antibodies
• Description: Rabbit polyclonal antibody to TGF beta 1
• Target: TGFB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1
• Protein Sequence: Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
• UniProt ID: P04202
• MW: 43kDa
• Tested applications: IF, IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-bet
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_035707

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Human Spleen

Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml.

TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain. Working dilutions: 5-10 ug/ml.

WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution. SP2/0 cell lysate.