You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb576457 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to TGF beta 1 |
Target | TGFB1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rat, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TGFB1 |
Protein Sequence | Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS |
UniProt ID | P04202 |
MW | 43kDa |
Tested applications | IF, IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | Tgfb, Tgfb-1, TGFbeta, TGF-beta, TGFbeta1, TGF-bet Read more... |
Note | For research use only |
NCBI | NP_035707 |
Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.
Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Human Spleen
Immunofluorescent TGFB1 detection in mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml.
TGFB1 in human prostate cancer tissue was detected using HRP/AEC red color stain. Working dilutions: 5-10 ug/ml.
WB Suggested Anti-TGFB1 Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 dilution. SP2/0 cell lysate.
ELISA, WB | |
Bovine, Canine, Guinea pig, Porcine, Rabbit, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Guinea pig, Porcine, Sheep | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Porcine, Rat, Sheep | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |