Human RSPO1 Protein

SKU: orb1477849

Featured

Active

Description

This Human RSPO1 Protein spans the amino acid sequence from region 31-263aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Stem Cell & Developmental Biology

Images & Validation

−

Item 1 of 2

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5, the EC50 is 124.0-174.1 ng/mL.
Tag	C-terminal 10xHis-Avi-tagged
Molecular Weight	30.2 kDa
Expression Region	31-263aa
Protein Length	Partial
Protein Sequence	RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Disclaimer	For research use only

Alternative Names

−

(Roof plate-specific spondin-1) (hRspo1)

Human RSPO1(21-146) Protein, hFc Tag [orb1290875]

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 39.9 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-146)-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Item 1 of 2
RSPO1 Antibody [orb668014]
Applications:
IHC, WB
Reactivity:
Human
Species/Host:
Rabbit
Clonality:
Polyclonal
Conjugation:
Unconjugated
Sizes Available: 30 μl, 50 μl, 100 μl, 200 μl

Item 1 of 1

Human RSPO1(21-263) Protein, His Tag [orb1290876]

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 27.6 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-263)-His is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 50 μg, 10 μg, 100 μg

Recombinant Human RSPO1 Protein, N-His [orb2967772]
Purity:
>90% as determined by SDS-PAGE.
MW:
15.00 kDa
Sizes Available: 1 mg, 100 μg, 50 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/ml can bind Human LGR5, the EC50 is 124.0-174.1 ng/mL.

Quick Database Links

UniProt

Q2MKA7

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols