You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human RSPO1 protein
Catalog Number: orb594926
| Catalog Number | orb594926 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human R-spondin-1(RSPO1),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q2MKA7 |
| MW | 27.8 kDa |
| Application notes | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells is 1-10ng/ml. |
| Expression Region | 31-263aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ409 Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Human RSPO1(21-146) Protein, hFc Tag [orb1290875]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.9 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-146)-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 2
Human RSPO1 Protein [orb1477849]
Greater than 95% as determined by SDS-PAGE.
30.2 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
Human RSPO1(21-263) Protein, His Tag [orb1290876]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 27.6 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-263)-His is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Human RSPO1 protein [orb392401]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg- Item 1 of 1
Recombinant human RSPO1 protein, C-His (HEK293) [orb1516340]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 38-42 kDa based on Tris-Bis PAGE result.
50 μg
