You have no items in your shopping cart.
Human RSPO1 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells is 1-10ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 27.8 kDa |
| Expression Region | 31-263aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human RSPO1 Protein [orb1477849]
Greater than 95% as determined by SDS-PAGE.
30.2 kDa
Mammalian cell
100 μg, 20 μg, 1 mgHuman RSPO1(21-146) Protein, hFc Tag [orb1290875]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.9 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-146)-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μgRSPO1 Rabbit Polyclonal Antibody [orb668014]
IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μlHuman RSPO1(21-263) Protein, His Tag [orb1290876]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 27.6 kDa after removal of the signal peptide. The apparent molecular mass of RSPO1(21-263)-His is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human RSPO1 protein (orb594926)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review







