You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human PLA2R1 protein
Catalog Number: orb246853
| Catalog Number | orb246853 |
|---|---|
| Category | Proteins |
| Description | Recombinant Homo sapiens Secretory phospholipase A2 receptor |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
| Protein Length | Partial |
| UniProt ID | Q13018 |
| MW | 17.4 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 395-530aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | PLA2R1 |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PLA2R1.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PLA2R1.
- Item 1 of 3
Human PLA2R1 protein [orb244826]
Greater than 90% as determined by SDS-PAGE.
19.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 2
Human PLA2R1 full length protein-synthetic nanodisc [orb1826412]
The human full length PLA2R1 protein has a MW of 168.6 kDa
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human PLA2R1(21-521+1097-1246) Protein, His Tag [orb1826808]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 76.0 kDa after removal of the signal peptide. The apparent molecular mass of PLA2R1(21-521 1097-1246)-10×His is approximately 70-130 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human PLA2R1(21-164+223-359+1097-1246) Protein, His Tag [orb1826809]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 50.3 kDa after removal of the signal peptide. The apparent molecular mass of PLA2R1(21-164 223-359 1097-1246)-10×His is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human PLA2R1 Protein, His Tag [orb1826810]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 160.5 kDa after removal of the signal peptide. The apparent molecular mass of PLA2R1-10×His is approximately 130-250 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
