You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244826 |
---|---|
Category | Proteins |
Description | Recombinant human Secretory phospholipase A2 receptor |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
Protein Length | Partial |
UniProt ID | Q13018 |
MW | 19.4 kDa |
Application notes | This is His-tag protein |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 395-530aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | PLA2R1 |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PLA2R1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PLA2R1.
Greater than 90% as determined by SDS-PAGE. | |
17.4 kDa | |
Yeast |
The human full length PLA2R1 protein has a MW of 168.6 kDa | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 76.0 kDa after removal of the signal peptide. The apparent molecular mass of PLA2R1(21-521 1097-1246)-10×His is approximately 70-130 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 50.3 kDa after removal of the signal peptide. The apparent molecular mass of PLA2R1(21-164 223-359 1097-1246)-10×His is approximately 35-70 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 160.5 kDa after removal of the signal peptide. The apparent molecular mass of PLA2R1-10×His is approximately 130-250 kDa due to glycosylation. | |
Mammalian |