You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human PIP protein
Catalog Number: orb418911
| Catalog Number | orb418911 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Prolactin-inducible |
| Tag | N-terminal 10xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 16 kDa |
| UniProt ID | P12273 |
| Protein Sequence | QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
| Protein Length | Full Length of Mature Protein |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 29-146aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Gross cystic disease fluid protein 15 Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 10xHis-taggedExpression Region: 29-146aaSequence Info: Full Length |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PIP.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PIP.
- Item 1 of 1
- Item 1 of 1
Human PIP protein [orb244441]
Greater than 90% as determined by SDS-PAGE.
17.5 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human PIP Protein, hFc Tag [orb1826778]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.7 kDa after removal of the signal peptide. The apparent molecular mass of PIP-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
