You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594742 |
---|---|
Category | Proteins |
Description | Recombinant Human Kit ligand(KITLG),partial (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 22 kDa |
UniProt ID | P21583 |
Protein Sequence | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH |
Protein Length | Partial |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 2-10 ng/ml. |
Expression Region | 26-214aa |
Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cel Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Unconjugated | |
95% | |
19.5 kDa | |
Mouse SCF, His Tag (orb257825) is expressed from human 293 cells (HEK293). It contains AA Lys 26 - Ala 189 (Accession # NP_038626). |
Unconjugated | |
95% | |
18.5 kDa | |
Human SCF (26-189), premium grade (orb1496171) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ala 189 (Accession # P21583-1). |
Unconjugated | |
90% | |
20.3 kDa | |
Human SCF, His Tag (orb1743048) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ala 189 (Accession # P21583-1). |
Greater than 90% as determined by SDS-PAGE. | |
45.5 kDa | |
E.coli |