You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246378 |
---|---|
Category | Proteins |
Description | Recombinant human Kit ligand |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 45.5 kDa |
UniProt ID | P21583 |
Protein Sequence | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 26-189aa. Protein Length: Partial |
Expression Region | 26-189aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | KITLG Read more... |
Note | For research use only |
Application notes | Partial of Soluble KIT ligand chain of GST-tag and expression region is 26-189aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
18.5 kDa | |
Human SCF (26-189), premium grade (orb1496171) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ala 189 (Accession # P21583-1). |
Unconjugated | |
90% | |
20.3 kDa | |
Human SCF, His Tag (orb1743048) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ala 189 (Accession # P21583-1). |
Unconjugated | |
95% | |
57.1 kDa | |
Human CD117, His Tag (orb257965) is expressed from human 293 cells (HEK293). It contains AA Gln 26 - Thr 516 (Accession # P10721-2). |
Unconjugated | |
95% | |
81.9 kDa | |
Human CD117, Fc Tag (orb334886) is expressed from human 293 cells (HEK293). It contains AA Gln 26 - Thr 516 (Accession # P10721-2). |
Greater than 85% as determined by SDS-PAGE. | |
48.6 kDa | |
Mammalian cell |
Filter by Rating