You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594728 |
---|---|
Category | Proteins |
Description | Recombinant Human Kit ligand(KITLG),partial (Active) |
Tag | Tag-Free |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0 |
Purity | Greater than 95% as determined by SDS-PAGE. |
Protein Sequence | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Protein Length | Partial |
UniProt ID | P21583 |
MW | 18.4 kDa |
Application notes | Partial |
Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 1-5 ng/ml. |
Expression Region | 26-189aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cel Read more... |
Research Area | Immunology & Inflammation |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 85% as determined by SDS-PAGE. | |
48.6 kDa | |
Mammalian cell |
Greater than 90% as determined by SDS-PAGE. | |
45.5 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
22 kDa | |
Mammalian cell |