You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL7 protein
Catalog Number: orb594798
| Catalog Number | orb594798 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-7(IL7) (Active) |
| Tag | Tag-Free |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P13232 |
| MW | 17.5 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 0.02-0.08 ng/ml. |
| Expression Region | 26-177aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-7; IL-7; IL7 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL7 protein (Active) [orb358973]
> 97% as determined by SDS-PAGE and HPLC.
17.4 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 1
Human IL7 protein [orb594803]
Greater than 95% as determined by SDS-PAGE.
18.4 kDa
Mammalian cell
500 μg, 10 μg, 50 μg, 1 mg - Item 1 of 1
- Item 1 of 1
Human IL-7 Protein [orb1471778]
Greater than 95% as determined by reducing SDS-PAGE.
17.5 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
Human IL7 Protein, hFc Tag [orb2321391]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.5 kDa after removal of the signal peptide. The apparent molecular mass of IL7-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
