You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594803 |
---|---|
Category | Proteins |
Description | Recombinant Human Interleukin-7(IL7) (Active) |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Lyophilized powder |
Purity | Greater than 95% as determined by SDS-PAGE. |
MW | 18.4 kDa |
UniProt ID | P13232 |
Protein Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Protein Length | Full Length of Mature Protein |
Source | Mammalian cell |
Expression System | 26-177aa |
Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood mononuclear cell (PBMC) is 50-300 pg/ml. |
Expression Region | 26-177aa |
Endotoxins | Less than 0.01 EU/µg as determined by LAL method. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alternative names | Interleukin-7; IL-7; IL7 Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97% as determined by SDS-PAGE and HPLC. | |
17.4 kDa | |
E.Coli |
Unconjugated | |
90% | |
19.9 kDa | |
Human Flt-3 Ligand, His Tag (orb257477) is expressed from human 293 cells (HEK293). It contains AA Thr 27 - Pro 185 (Accession # P49771-1). |
Greater than 95% as determined by SDS-PAGE. | |
17.5 kDa | |
E.coli |
Unconjugated | |
95% | |
51.8 kDa | |
Human IL-7 R alpha, Fc Tag (orb1496263) is expressed from human 293 cells (HEK293). It contains AA Glu 21 - Asp 239 (Accession # P16871-1). |
Unconjugated | |
90% | |
16.8 kDa | |
Mouse IL-7, His Tag (orb1496304) is expressed from human 293 cells (HEK293). It contains AA Glu 26 - Ile 154 (Accession # Q544C8). |
Filter by Rating