Human IL 1 beta Protein

SKU: orb168624

Description

Recombinant of Human IL 1 beta protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: HEK
• Biological Activity: The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.
• Protein Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Purity: Greater than 95% as obsereved by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The IL-1 beta was lyophilized from 1mg/ml in 1xPBS.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.