You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml. |
| Tag | Tag-Free |
| Expression Region | 104-330aa(D239E,L241M) |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 25.9 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human IgG1 Fc Protein [orb2992939]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 23.8 KDa. Observed: 30-34 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human IgG1 Fc Protein (Biotin) [orb2993718]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 27.7 KDa. Observed: 33 KDa, reducing conditions
100 μg, 20 μgRecombinant Human IgG1 Fc Protein [orb2993960]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 25.9 KDa. Observed: 32 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgCCND1 Antibody [orb518802]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].







