You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
Human GLP1R Protein
Catalog Number: orb1476707
| Catalog Number | orb1476707 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Glucagon-like peptide 1 receptor(GLP1R),partial (Active) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 19.3 kDa |
| UniProt ID | P43220 |
| Protein Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is 54.54-94.23 ng/mL. |
| Expression Region | 24-145aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alternative names | (GLP-1 receptor)(GLP-1-R)(GLP-1R) Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is 54.54-94.23 ng/mL.
- Item 1 of 4
Human GLP1R Protein, hFc Tag [orb1743290]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.7 kDa after removal of the signal peptide. The apparent molecular mass of GLP1R-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 2
Human GLP1R full length protein-synthetic nanodisc [orb1743150]
The human full length GLP1R protein has a MW of 53.0 kDa
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human GLP1R protein [orb419298]
Greater than 85% as determined by SDS-PAGE.
16.8 kDa
Baculovirus
1 mg, 100 μg, 20 μg - Item 1 of 1
Human GLP1R protein [orb245848]
Greater than 90% as determined by SDS-PAGE.
16.3 kDa
Yeast
100 μg, 20 μg, 1 mg - Item 1 of 1
Human GLP1R protein [orb383448]
Greater than 90% as determined by SDS-PAGE.
18.3 kDa
Mammalian cell
20 μg, 1 mg, 100 μg
