You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human GLP1R at 2 μg/mL can bind Anti-GLP1R recombinant antibody, the EC50 is 54.54-94.23 ng/mL. |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 24-145aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 19.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human GLP1R Protein, hFc Tag [orb1743290]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.7 kDa after removal of the signal peptide. The apparent molecular mass of GLP1R-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgRecombinant Human GLP1R N-ECD Protein [orb2992934]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 40.4 KDa. Observed: 54-66 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human GLP1R Protein [orb2994095]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 41.2 KDa. Observed: 50-75 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].











