You have no items in your shopping cart.
Cart summary
Human GIPR protein
Catalog Number: orb604121
| Catalog Number | orb604121 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Gastric inhibitory polypeptide receptor(GIPR),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 17.5 kDa |
| UniProt ID | P48546 |
| Protein Sequence | RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 22-138aa. Protein Length: Partial |
| Expression Region | 22-138aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Glucose-dependent insulinotropic polypeptide recep Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
Human GIPR protein [orb605220]
Greater than 90% as determined by SDS-PAGE.
18.5 kDa
Mammalian cell
20 μg, 100 μg, 1 mgHuman GIPR protein [orb594982]
Greater than 85% as determined by SDS-PAGE.
17.3 kDa
Baculovirus
20 μg, 100 μg, 500 μg, 1 mgHuman GIPR Protein [orb1476796]
Greater than 85% as determined by SDS-PAGE.
52.4 kDa
in vitro E.coli expression system
20 μg, 100 μgHuman GIPR Protein, hFc Tag [orb1743292]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.6 kDa after removal of the signal peptide. The apparent molecular mass of GIPR-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgHuman GIPR full length protein-synthetic nanodisc [orb1743141]
The human full length GIPR protein has a MW of 53.2 kDa
Mammalian
10 μg, 50 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars