You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human FGF17 protein
Catalog Number: orb594739
| Catalog Number | orb594739 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Fibroblast growth factor 17(FGF17) (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | O60258 |
| MW | 22.64 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 2.1 ug/ml. |
| Expression Region | 23-216aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Fibroblast Growth Factor 17; FGF-17; FGF17 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human FGF17 protein (Active) [orb359156]
> 95% as determined by SDS-PAGE and HPLC.
22.6 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 1
Human FGF-17 Protein [orb1471726]
Greater than 95% as determined by reducing SDS-PAGE.
22.6 KDa
Mammalian
10 μg, 50 μg 
Human FGF17 protein [orb391724]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgHuman FGF17 protein [orb391725]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μgRecombinant Human FGF17 Protein, N-His [orb2836994]
> 90% as determined by SDS-PAGE.
22.81 kDa
100 μg, 50 μg, 20 μg
