Cart summary

You have no items in your shopping cart.

Human FGF17 protein (Active)

Catalog Number: orb359156

DispatchUsually dispatched within 1-2 weeks
$ 210.00
Catalog Numberorb359156
CategoryProteins
DescriptionRecombinant human FGF17 active protein
TagTag-Free
Form/AppearanceLyophilized powder
Purity> 95% as determined by SDS-PAGE and HPLC.
MW22.6 kDa
UniProt IDO60258
Protein SequenceM+TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT
Protein LengthFull Length of Mature Protein
SourceE.Coli
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 10 ng/ml, corresponding to a specific activity of >1.0 × 105 IU/mg.
Expression Region23-216aa
EndotoxinsLess than 1.0 EU/µg as determined by LAL method.
StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/PreservativesLyophilized from a 0.2 µm filtered PBS, pH 7.4
Alternative namesFGF-17,
Read more...
NoteFor research use only
Application notesWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Expiration Date6 months from date of receipt.
Human FGF17 protein (Active)

SDS-PAGE analysis of Human FGF17 protein (Active)