You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cardiovascular Research
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.2-2 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 16-155aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 15.9 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris, 400 mM NaCl, 1 mM DTT, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast Growth Factor 1; FGF-1; Acidic Fibroblast Growth Factor; aFGF; Endothelial Cell Growth Factor; ECGFHeparin-Binding Growth Factor 1; HBGF-1; FGF1; FGFA
Similar Products
−- Item 1 of 4
- Item 1 of 1
FGF1/aFGF Mouse Monoclonal Antibody [orb2974669]
ELISA, FC
Human
Mouse
Monoclonal
Unconjugated
50 μg, 100 μg - Item 1 of 1
Human FGF1 protein [orb244204]
Greater than 90% as determined by SDS-PAGE.
31.8 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Human FGF1 protein (Active) [orb359150]
> 95% as determined by SDS-PAGE and HPLC.
16.0 kDa
E.Coli
500 μg, 100 μg, 10 μg - Item 1 of 1
Human FGF1 protein [orb419317]
> 97% as determined by SDS-PAGE and HPLC.
17.5 kDa
E.Coli
500 μg, 100 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks